LRCH4 Fragment MS Protein Standard

Leucine-rich repeat and calponin homology domain-containing protein 4

LRCH4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LRCH4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LRCH4

Leucine-rich repeat neuronal protein 4

O75427

LPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRYPQVPDEKDLMTQLRQVLESRLQ