LZIC Fragment MS Protein Standard

Protein LZIC

LZIC Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LZIC protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LZIC

Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein

Q8WZA0

MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFK