MAATS1 Fragment MS Protein Standard

Protein MAATS1

MAATS1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAATS1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAATS1

AMY-1-associating protein expressed in testis 1, MYCBP/AMY-1-associated testis-expressed protein 1

Q7Z4T9

RKVPRFKTMFSNLIHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTTTDASFQMPKEVYEDPEVTGKNRYKYFERPFLPFFQQMPFNVVYAVSK