MDM4 Fragment MS Protein Standard

Protein Mdm4

MDM4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MDM4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MDM4

Double minute 4 protein, Mdm2-like p53-binding protein, Protein Mdmx, p53-binding protein Mdm4

O15151

SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP