MECR Fragment MS Protein Standard

Trans-2-enoyl-CoA reductase, mitochondrial

MECR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MECR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MECR

Nuclear receptor-binding factor 1

Q9BV79

SSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM