MED22 Fragment MS Protein Standard

Mediator of RNA polymerase II transcription subunit 22

MED22 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MED22 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MED22

Mediator complex subunit 22, Surfeit locus protein 5

Q15528

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRN