MTF2 Fragment MS Protein Standard

Metal-response element-binding transcription factor 2

MTF2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MTF2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MTF2

Metal regulatory transcription factor 2, Metal-response element DNA-binding protein M96, Polycomb-like protein 2

Q9Y483

AHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEI