NARFL Fragment MS Protein Standard

Cytosolic Fe-S cluster assembly factor NARFL

NARFL Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NARFL protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NARFL

Iron-only hydrogenase-like protein 1, Nuclear prelamin A recognition factor-like protein, Protein related to Narf

Q9H6Q4

RCPYHYVEVMACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELYTHWLQGTDSECAGRL