NCF4 Fragment MS Protein Standard

Neutrophil cytosol factor 4

NCF4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NCF4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NCF4

Neutrophil NADPH oxidase factor 4, SH3 and PX domain-containing protein 4, p40-phox

Q15080

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY