NDUFA10 Fragment MS Protein Standard

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

NDUFA10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NDUFA10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NDUFA10

Complex I-42kD, NADH-ubiquinone oxidoreductase 42 kDa subunit

O95299

TGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGD