NENF Fragment MS Protein Standard

Neudesin

NENF Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NENF protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NENF

Cell immortalization-related protein 2, Neuron-derived neurotrophic factor, Secreted protein of unknown function

Q9UMX5

RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS