NFE2L1 Fragment MS Protein Standard

Product Information
Protein Name
Nuclear factor erythroid 2-related factor 1
Description
NFE2L1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NFE2L1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
NFE2L1
Synonyms
Locus control region-factor 1, Nuclear factor, erythroid derived 2, like 1, Transcription factor 11, Transcription factor HBZ17, Transcription factor LCR-F1
Uniprot ID
Q14494
Product Sequence
LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket