NFIL3 Fragment MS Protein Standard

Product Information
Protein Name
Nuclear factor interleukin-3-regulated protein
Description
NFIL3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NFIL3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
NFIL3
Synonyms
E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A
Uniprot ID
Q16649
Product Sequence
KVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKDSGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISAS

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket