NOL6 Fragment MS Protein Standard

Nucleolar protein 6

NOL6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NOL6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NOL6

Nucleolar RNA-associated protein

Q9H6R4

PQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPML