NR1I2 Fragment MS Protein Standard

Nuclear receptor subfamily 1 group I member 2

NR1I2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NR1I2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NR1I2

Orphan nuclear receptor PAR1, Orphan nuclear receptor PXR, Pregnane X receptor, Steroid and xenobiotic receptor

O75469

GVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS