NT5C1B Fragment MS Protein Standard

Cytosolic 5-nucleotidase 1B

NT5C1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NT5C1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NT5C1B

Autoimmune infertility-related protein, Cytosolic 5-nucleotidase IB

Q96P26

SQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQG