PARD3B Fragment MS Protein Standard

Product Information
Protein Name
Partitioning defective 3 homolog B
Description
PARD3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PARD3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
PARD3B
Synonyms
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein, PAR3-beta, Partitioning defective 3-like protein
Uniprot ID
Q8TEW8
Product Sequence
ARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYPQ

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket