PATZ1 Fragment MS Protein Standard

Product Information
Protein Name
POZ-, AT hook-, and zinc finger-containing protein 1
Description
PATZ1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PATZ1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
PATZ1
Synonyms
BTB/POZ domain zinc finger transcription factor, Protein kinase A RI subunit alpha-associated protein, Zinc finger and BTB domain-containing protein 19, Zinc finger protein 278, Zinc finger sarcoma gene protein
Uniprot ID
Q9HBE1
Product Sequence
LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket