PDCD4 Fragment MS Protein Standard

Programmed cell death protein 4

PDCD4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PDCD4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PDCD4

Neoplastic transformation inhibitor protein, Nuclear antigen H731-like, Protein 197/15a

Q53EL6

VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE