PFKM Fragment MS Protein Standard

ATP-dependent 6-phosphofructokinase, muscle type

PFKM Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PFKM protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PFKM

6-phosphofructokinase type A, Phosphofructo-1-kinase isozyme A, Phosphohexokinase

P08237

CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA