PHLPP1 Fragment MS Protein Standard

PH domain leucine-rich repeat-containing protein phosphatase 1

PHLPP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PHLPP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PHLPP1

Pleckstrin homology domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein

O60346

SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ