PLA2G3 Fragment MS Protein Standard

Group 3 secretory phospholipase A2

PLA2G3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PLA2G3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PLA2G3

Group III secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 3

Q9NZ20

GHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFV