POMGNT2 Fragment MS Protein Standard

Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2

POMGNT2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POMGNT2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

POMGNT2

Extracellular O-linked N-acetylglucosamine transferase-like, Glycosyltransferase-like domain-containing protein 2

Q8NAT1

FKWLCYSNEAEEFIFFHGNTSVMLPNLGSRRFQPALLDLSTVEDHNTQYFNFVELPAAALRFMPKPVFVPDV