POU5F2 Fragment MS Protein Standard

POU domain, class 5, transcription factor 2

POU5F2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POU5F2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

POU5F2

Sperm 1 POU domain transcription factor

Q8N7G0

QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP