PPIP5K1 Fragment MS Protein Standard

Product Information
Protein Name
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
Description
PPIP5K1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPIP5K1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
PPIP5K1
Synonyms
Diphosphoinositol pentakisphosphate kinase 1, Histidine acid phosphatase domain-containing protein 2A, IP6 kinase, Inositol pyrophosphate synthase 1, InsP6 and PP-IP5 kinase 1, VIP1 homolog
Uniprot ID
Q6PFW1
Product Sequence
IEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQEVPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKVS

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket