PPIP5K1 Fragment MS Protein Standard

Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1

PPIP5K1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPIP5K1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPIP5K1

Diphosphoinositol pentakisphosphate kinase 1, Histidine acid phosphatase domain-containing protein 2A, IP6 kinase, Inositol pyrophosphate synthase 1, InsP6 and PP-IP5 kinase 1, VIP1 homolog

Q6PFW1

IEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQEVPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKVS