PPP1R3B Fragment MS Protein Standard

Protein phosphatase 1 regulatory subunit 3B

PPP1R3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPP1R3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPP1R3B

Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL

Q86XI6

MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVF