PPP6R3 Fragment MS Protein Standard

Serine/threonine-protein phosphatase 6 regulatory subunit 3

PPP6R3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PPP6R3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PPP6R3

SAPS domain family member 3, Sporulation-induced transcript 4-associated protein SAPL

Q5H9R7

ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSS