PRDM6 Fragment MS Protein Standard

Putative histone-lysine N-methyltransferase PRDM6

PRDM6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRDM6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRDM6

PR domain zinc finger protein 6, PR domain-containing protein 6

Q9NQX0

ELPEWLRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKVQAGAVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGE