PRIMPOL Fragment MS Protein Standard

DNA-directed primase/polymerase protein

PRIMPOL Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRIMPOL protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRIMPOL

Coiled-coil domain-containing protein 111

Q96LW4

SIWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKPAN