PRKAA1 Fragment MS Protein Standard

5-AMP-activated protein kinase catalytic subunit alpha-1

PRKAA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRKAA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRKAA1

Acetyl-CoA carboxylase kinase, Hydroxymethylglutaryl-CoA reductase kinase, Tau-protein kinase PRKAA1

Q13131

RSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQG