PSIP1 Fragment MS Protein Standard

PC4 and SFRS1-interacting protein

PSIP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PSIP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PSIP1

CLL-associated antigen KW-7, Dense fine speckles 70 kDa protein, Lens epithelium-derived growth factor, Transcriptional coactivator p75/p52

O75475

DKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQ