PTGFRN Fragment MS Protein Standard

Product Information
Protein Name
Prostaglandin F2 receptor negative regulator
Description
PTGFRN Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PTGFRN protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
PTGFRN
Synonyms
CD9 partner 1, Glu-Trp-Ile EWI motif-containing protein F, Prostaglandin F2-alpha receptor regulatory protein, Prostaglandin F2-alpha receptor-associated protein
Uniprot ID
Q9P2B2
Product Sequence
TSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAALDPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQVHGSEDQDFGNYYCSVTPWVK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket