RAB5C Fragment MS Protein Standard

Ras-related protein Rab-5C

RAB5C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RAB5C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RAB5C

L1880, RAB5L

P51148

NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN