RENBP Fragment MS Protein Standard

N-acylglucosamine 2-epimerase

RENBP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RENBP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RENBP

GlcNAc 2-epimerase, N-acetyl-D-glucosamine 2-epimerase, Renin-binding protein

P51606

RILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIA