RGS7BP Fragment MS Protein Standard

Regulator of G-protein signaling 7-binding protein

RGS7BP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RGS7BP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RGS7BP

R7 family-binding protein

Q6MZT1

PVDSQQHSWQVSTDIENTERDMREMKNLLSKLRETMPLPLKNQDDSSLLNLTPYPLVRRRKRRFFGLCCLISS