RNF19A Fragment MS Protein Standard

Product Information
Protein Name
E3 ubiquitin-protein ligase RNF19A
Description
RNF19A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RNF19A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
RNF19A
Synonyms
Double ring-finger protein, RING finger protein 19A, p38
Uniprot ID
Q9NV58
Product Sequence
NSYIPLDKEGNSMEVQVDIESKPSKFRHNSGSSSVDDGSATRSHAGGSSSGLPEGKSSATKWSKEATAG

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
0
Inquiry Basket

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x