RNF19A Fragment MS Protein Standard

E3 ubiquitin-protein ligase RNF19A

RNF19A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RNF19A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RNF19A

Double ring-finger protein, RING finger protein 19A, p38

Q9NV58

EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL