RPS6KA4 Fragment MS Protein Standard

Ribosomal protein S6 kinase alpha-4

RPS6KA4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RPS6KA4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RPS6KA4

90 kDa ribosomal protein S6 kinase 4, Nuclear mitogen- and stress-activated protein kinase 2, Ribosomal protein kinase B

O75676

AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQGSFSVC