Description
RPS6KC1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RPS6KC1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Synonyms
52 kDa ribosomal protein S6 kinase, Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein, SPHK1-binding protein
Product Sequence
QGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASR
If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!
* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
