RREB1 Fragment MS Protein Standard

Ras-responsive element-binding protein 1

RREB1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RREB1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RREB1

Finger protein in nuclear bodies, Raf-responsive zinc finger protein LZ321, Zinc finger motif enhancer-binding protein 1

Q92766

GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF