RSC1A1 Fragment MS Protein Standard

Regulatory solute carrier protein family 1 member 1

RSC1A1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RSC1A1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RSC1A1

Transporter regulator RS1

Q92681

KLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGVEISPKLLAGEEDALNQTSEQTK