RUSC2 Fragment MS Protein Standard

Iporin

RUSC2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RUSC2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RUSC2

Interacting protein of Rab1, RUN and SH3 domain-containing protein 2

Q8N2Y8

QPSPFESKMSYESHHPESGGREGGYGCPHASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISP