S100A12 Fragment MS Protein Standard

Protein S100-A12

S100A12 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human S100A12 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

S100A12

CGRP, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Extracellular newly identified RAGE-binding protein, Migration inhibitory factor-related protein 6, Neutrophil S100 protein, S100 calcium-binding protein A12

P80511

KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE