SAMD4A Fragment MS Protein Standard

Protein Smaug homolog 1

SAMD4A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SAMD4A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SAMD4A

Sterile alpha motif domain-containing protein 4A

Q9UPU9

MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS