SCLT1 Fragment MS Protein Standard

Sodium channel and clathrin linker 1

SCLT1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SCLT1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SCLT1

Sodium channel-associated protein 1

Q96NL6

KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE