Description
SCNN1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SCNN1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Synonyms
Alpha-NaCH, Epithelial Na(+) channel subunit alpha, Nonvoltage-gated sodium channel 1 subunit alpha, SCNEA
Product Sequence
RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLR
If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!
* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.