SEL1L3 Fragment MS Protein Standard

Protein sel-1 homolog 3

SEL1L3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SEL1L3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SEL1L3

Suppressor of lin-12-like protein 3

Q68CR1

SMNLGYKHYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAA