SELE Fragment MS Protein Standard

E-selectin

SELE Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SELE protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SELE

CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, Leukocyte-endothelial cell adhesion molecule 2

P16581

SFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVP