SERPINA12 Fragment MS Protein Standard

Serpin A12

SERPINA12 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SERPINA12 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SERPINA12

OL-64, Visceral adipose tissue-derived serine protease inhibitor, Visceral adipose-specific serpin

Q8IW75

GTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPY