SH3GL1 Fragment MS Protein Standard

Endophilin-A2

SH3GL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SH3GL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SH3GL1

EEN fusion partner of MLL, Endophilin-2, Extra eleven-nineteen leukemia fusion gene protein, SH3 domain protein 2B, SH3 domain-containing GRB2-like protein 1

Q99961

VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHE